PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_69621.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family NAC
Protein Properties Length: 392aa    MW: 42371.4 Da    PI: 6.6811
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_69621.2genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM158.13.5e-49451702128
           NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkge 98 
                   +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  ++++
  MLOC_69621.2  45 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSR 140
                   79***************************.89***************7777899******************************************* PP

           NAM  99 lvglkktLvfykgrapkgektdWvmheyrl 128
                    +glkktLvfy+g+apkg++++W+m+eyrl
  MLOC_69621.2 141 PIGLKKTLVFYSGKAPKGVRSSWIMNEYRL 170
                   ****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-5744193IPR003441NAC domain
PROSITE profilePS5100554.88544193IPR003441NAC domain
PfamPF023651.5E-2446170IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MSRDIDEGSV SAATAGGGGG EVGGEPAAGV GDEAAVDSHE NDLVMPGFRF HPTEEELIEF  60
YLRRKVEGRR FNVELITFLD LYRFDPWELP AMAVIGEKEW FFYVPRDRKY RNGDRPNRVT  120
ASGYWKATGA DRMIRGENSR PIGLKKTLVF YSGKAPKGVR SSWIMNEYRL PPPTTDADLF  180
YKSEISLCRV YKRSGIDDGH GRPSSSNVQA ASARPGTSRI IIPPAGQQVS SPSATPLSPT  240
QQPSFHGLVG QGECSSAPLP AIMDQGTQHN NAPQLHQPPP PPPPRPSAYA SAMSSTMSVA  300
PAERACTYSL MALADAPMMG SSSTAGDELS RLVGHSQAYP NHPAVGSHFL PSPSSSQIPP  360
LGEMPVSPAD KLWDWIHPDT TGSRDYGSSS FK
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-554619419166NAC domain-containing protein 19
4dul_A2e-554619419166NAC domain-containing protein 19
1ut7_B2e-554619419166NO APICAL MERISTEM PROTEIN
1ut7_A2e-554619419166NO APICAL MERISTEM PROTEIN
1ut4_B2e-554619419166NO APICAL MERISTEM PROTEIN
1ut4_A2e-554619419166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231368.11e-160PREDICTED: protein FEZ isoform X2
TrEMBLM0YID10.0M0YID1_HORVD; Uncharacterized protein
STRINGMLOC_69621.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.22e-97NAC domain containing protein 35